Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ERGIC1)

This Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ERGIC1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q969X5

Expression Region

1-290

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ FSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSN PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis CV Cartridge Waters M45 501 510 515 590 600 610 Perf Plus
CHR6228 1 Each

Kinesis CV Cartridge Waters M45 501 510 515 590 600 610 Perf Plus

Sign In for Pricing
View Details
GDPD3 Polyclonal Antibody, PerCP Conjugated
bs-9206R-PerCP-01 20 µL

GDPD3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
GDPD3 Polyclonal Antibody, PerCP Conjugated
bs-9206R-PerCP-02 100 µL

GDPD3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Recombinant Human TARS3 Protein, N-His
AP97776 50 µg

Recombinant Human TARS3 Protein, N-His

Sign In for Pricing
View Details
Barbituric acid
262160-01 100 g

Barbituric acid

Sign In for Pricing
View Details
Barbituric acid
262160-02 500 g

Barbituric acid

Sign In for Pricing
View Details