Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Popeye domain-containing protein 3 (POPDC3)

This Recombinant Human Popeye domain-containing protein 3 (POPDC3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9HBV1

Expression Region

1-291

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P98 CRISPR Knock Out 293T Cell Line (Human)
41106141 1x 10^6 Cells / 1.0 mL

RPL21P98 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human TXNDC5 activation kit by CRISPRa
GA113071 1 Kit

Human TXNDC5 activation kit by CRISPRa

Sign In for Pricing
View Details
Red Fluorescent PLGA nanoparticles, 200nm
HY-172174A 1 Each

Red Fluorescent PLGA nanoparticles, 200nm

Sign In for Pricing
View Details
C4B Antibody
OACD02081-1ML 1 mL

C4B Antibody

Sign In for Pricing
View Details
Phospho-TEK(Y1113) Antibody Blocking peptide
MBS9225184-01 0.5 mg

Phospho-TEK(Y1113) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-TEK(Y1113) Antibody Blocking peptide
MBS9225184-02 5x 0.5 mg

Phospho-TEK(Y1113) Antibody Blocking peptide

Sign In for Pricing
View Details