Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Popeye domain-containing protein 3 (POPDC3)

This Recombinant Human Popeye domain-containing protein 3 (POPDC3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9HBV1

Expression Region

1-291

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21ORF33 Antibody
OACA03456-50UG 50 µg

C21ORF33 Antibody

Sign In for Pricing
View Details
GFPT2, ID (GFPT2, Glucosamine-fructose-6-phosphate aminotransferase [isomerizing] 2, D-fructose-6-phosphate amidotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, Hexosephosphate aminotransferase 2) (MaxLight 750)
MBS6301982-01 0.1 mL

GFPT2, ID (GFPT2, Glucosamine-fructose-6-phosphate aminotransferase [isomerizing] 2, D-fructose-6-phosphate amidotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, Hexosephosphate aminotransferase 2) (MaxLight 750)

Sign In for Pricing
View Details
GFPT2, ID (GFPT2, Glucosamine-fructose-6-phosphate aminotransferase [isomerizing] 2, D-fructose-6-phosphate amidotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, Hexosephosphate aminotransferase 2) (MaxLight 750)
MBS6301982-02 5x 0.1 mL

GFPT2, ID (GFPT2, Glucosamine-fructose-6-phosphate aminotransferase [isomerizing] 2, D-fructose-6-phosphate amidotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, Hexosephosphate aminotransferase 2) (MaxLight 750)

Sign In for Pricing
View Details
Monoacylglycerol Lipase (MGLL) (NM_001003794) Human Tagged ORF Clone Lentiviral Particle
RC202412L1V 200 µL

Monoacylglycerol Lipase (MGLL) (NM_001003794) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NPFF Rabbit Polyclonal Antibody (Cy7)
orb1037908 100 µL

NPFF Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Rat NAD (P)H-hydrate epimerase
MBS1010491-01 0.02 mg (E-Coli)

Recombinant Rat NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details