Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Prohibitin-2 (phbB)

This Recombinant Dictyostelium discoideum Prohibitin-2 (phbB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Prohibitin-2

UniProt

Q54Q31

Expression Region

1-293

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNKKFQVNFNNIPKLPKGSFGGGFGLLALGGVGLLALSSLVNVEGGHRAIVFNRFVGIK NKVYNEGTHFIVPWFERAEIYDVRAKPRSISSLTGSKDLQMVNITIRVLSKPKVSQLPAI YRTLGKDYDERVLPSIVNEILKSIVAQFNASQLITQREQVSRLIFKRLVDRAKDFNIELD DVSITHLNFGREYAAAIEAKQVAQQEAERARFLVEKALQDKRSIIVKAEGEAQSAQLIND AIKQSPYLVQLRTLEASKEIAHILSKSPNKLYISNETLLLNGFDLNNNQQPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAR alpha Rabbit pAb, BF700 conjugated
orb2825331 100 µL

PPAR alpha Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
NEK7 Adenovirus (Mouse)
31714054 1.0 mL

NEK7 Adenovirus (Mouse)

Sign In for Pricing
View Details
RET (NM_020975) Human Mutant ORF Clone
RC403227 10 µg

RET (NM_020975) Human Mutant ORF Clone

Sign In for Pricing
View Details
Camel Tartrate Resistant Acid Phosphatase ELISA Kit
MBS090248-01 48 Well

Camel Tartrate Resistant Acid Phosphatase ELISA Kit

Sign In for Pricing
View Details
Camel Tartrate Resistant Acid Phosphatase ELISA Kit
MBS090248-02 96 Well

Camel Tartrate Resistant Acid Phosphatase ELISA Kit

Sign In for Pricing
View Details
Camel Tartrate Resistant Acid Phosphatase ELISA Kit
MBS090248-03 5x 96 Well

Camel Tartrate Resistant Acid Phosphatase ELISA Kit

Sign In for Pricing
View Details