Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Prohibitin-2 (phbB)

This Recombinant Dictyostelium discoideum Prohibitin-2 (phbB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Prohibitin-2

UniProt

Q54Q31

Expression Region

1-293

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNKKFQVNFNNIPKLPKGSFGGGFGLLALGGVGLLALSSLVNVEGGHRAIVFNRFVGIK NKVYNEGTHFIVPWFERAEIYDVRAKPRSISSLTGSKDLQMVNITIRVLSKPKVSQLPAI YRTLGKDYDERVLPSIVNEILKSIVAQFNASQLITQREQVSRLIFKRLVDRAKDFNIELD DVSITHLNFGREYAAAIEAKQVAQQEAERARFLVEKALQDKRSIIVKAEGEAQSAQLIND AIKQSPYLVQLRTLEASKEIAHILSKSPNKLYISNETLLLNGFDLNNNQQPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IER5L CRISPR Knock Out 293T Cell Line (Human)
24205141 1x 10^6 Cells / 1.0 mL

IER5L CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GOLGA6L10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22374111 3x 1.0 µg

GOLGA6L10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
4-Methoxy-6- (2-phenylethyl) -2H-pyran-2-one-d3
161470 1 mg

4-Methoxy-6- (2-phenylethyl) -2H-pyran-2-one-d3

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, Homeobox Protein Hox-A5, Homeobox Protein Hox-1C, HOX1C, MGC9376) (APC)
128012-APC 100 µL

HOXA5 (Homeobox A5, Homeobox Protein Hox-A5, Homeobox Protein Hox-1C, HOX1C, MGC9376) (APC)

Sign In for Pricing
View Details
C4orf3 Antibody (HRP)
orb351790-01 50 µg

C4orf3 Antibody (HRP)

Sign In for Pricing
View Details
C4orf3 Antibody (HRP)
orb351790-02 100 µg

C4orf3 Antibody (HRP)

Sign In for Pricing
View Details