Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D NADH-cytochrome b5 reductase 1 (CBR1)

This Recombinant Cryptococcus neoformans var. neoformans serotype D NADH-cytochrome b5 reductase 1 (CBR1) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 1, EC= 1.6.2.2, Microsomal cytochrome b reductase

UniProt

P0CP15

Expression Region

1-294

Origin

Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTIEVLAQKLAPHASFLGGLVVAAILGLFIFFQEKDRKVLDPVEWRSFKLVDKDHLSHN TALYRFALPRASDSLGLPIGQHISVAAEINGKQVVRSYTPTTLDDDKGHFDLVVKTYEKG NISRYLSLLTIGQEIKVKGPKGKFVYTPNMAPHLVMIAGGTGITPMYQIIKSSIKTPGDK TRLSLIYANIQEDDILLKKEIDELQAKSNGRFDVKYVLNNPPEGWTGGVGFVTKEMIEEA MPSSGVGSANHGEGHKVLMCGPPPMITAMKGHLAQIGYPAPRSVSKLEDQVFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD3 Antibody
orb1322197-01 30 µL

PSMD3 Antibody

Sign In for Pricing
View Details
PSMD3 Antibody
orb1322197-02 50 μL

PSMD3 Antibody

Sign In for Pricing
View Details
PSMD3 Antibody
orb1322197-03 100 µL

PSMD3 Antibody

Sign In for Pricing
View Details
COL17A1 CRISPR Knock Out 293T Cell Line (Human)
16558141 1x 10^6 Cells / 1.0 mL

COL17A1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human DEC2 Affinity Purified Polyclonal Ab
AF5226-SP 25 µg

Human DEC2 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Anti-NCAM Antibody (6L815)
TMAH-00805-01 50 μL

Anti-NCAM Antibody (6L815)

Sign In for Pricing
View Details