Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Podospora anserina Alternative oxidase, mitochondrial (AOX1)

This Recombinant Podospora anserina Alternative oxidase, mitochondrial (AOX1) spans the amino acid sequence from region 67-363.

Product Specifications

Product Name Alternative

Alternative oxidase, mitochondrial, EC= 1.-.-.-

UniProt

Q9C206

Expression Region

67-363

Origin

Podospora anserina (Pleurage anserina)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LKDFFPVKETAYIRKTPPAWPHHGYTEEEMLAVVPQHRKPGSLSDWLAWKLVRLCRWGTD IATGIKPEQQVDKSNPTTAVAAQKPLTEAQWLVRFIFLESIAGVPGMVAGMLRHLESLRR LKRDNGWIETLLEESYNERMHLLTFMKMCEPGWFMKTMILGAQGVFFNAMFLSYLISPRI THRFVGYLEEEAVHTYTRCIREIEQGDLPKWSDPNFQIPDLAVTYWKMPEGKRTMRDLIL YIRADEAVHRGVNHTLSNLNHKEDPNPFVSDYKCDADHQRPNPALKPTGFERSEVIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details