Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

P21115

Expression Region

18-317

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCT VSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLIS GSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloropyridine N-Oxide
TRC-C380625-500MG 500 mg

3-Chloropyridine N-Oxide

Sign In for Pricing
View Details
Ethyl 2,2-Dichloro-3-oxobutanoate
TRC-E903078-50MG 50 mg

Ethyl 2,2-Dichloro-3-oxobutanoate

Sign In for Pricing
View Details
Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)
PKSM040969-01 10 µg

Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)
PKSM040969-02 50 µg

Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)

Sign In for Pricing
View Details
GADL1 (NM_207359) Human Over-expression Lysate
LY432286 100 µg

GADL1 (NM_207359) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF647 conjugate, 0.1mg/mL
BNC471076-500 1x 500 µL

Cytokeratin, HMW (KRTH/1076), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details