Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine E3 ubiquitin-protein ligase RNF144B (RNF144B)

This Recombinant Bovine E3 ubiquitin-protein ligase RNF144B (RNF144B) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF144B, EC= 6.3.2.-, RING finger protein 144B

UniProt

A5PK27

Expression Region

1-304

Origin

Bos taurus (Bovine)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVGRLHCLTMTAAENPTPGDLALVPLVTCKLCLCEQSLDKMTTLQECRCIFCTACLKQ YMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPCRT WCPVADCQTVCPVATSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPGILPTEHG TLFGTETDAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDRGP CRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHD PSTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF488A conjugate, 0.1mg/mL
BNC880764-100 1x 100 µL

CD79a (IGA/764), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL
BNC881042-100 1x 100 µL

TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL
BNC740948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details