Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2048

UniProt

O28231

Expression Region

1-307

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKQMEKKSARLLAFLLALIMIGSVFAYMLSGGSAEHREVVYRLDDFREYVNWTPADPVY VQYYNLSYTSKLGSKDPLASMVTTDLQKLLIPAIFSRQVLEVTRGISQVMIVDFGETVPL YFVDAGMSKIYFAKEDEIKHGNFTLQVRRPGIALVSELSPLVVGYKPLVEKAVDTVEGNY PSFGNKTYSYLSRINGSFAYAFFAYGDVVKQWIRVGNESPADFFFEGYRYNFNNSSYEKV WAMHFEGNYFFGGMNESEKNFEYYKVQNFGDGLSVAVMEDKNFTKVVNARPNILTWQISF NNTQNES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP6 Antibody
KC-12141-01 50 μL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-12141-02 100 µL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-12141-03 1 mL

GBP6 Antibody

Sign In for Pricing
View Details
Bulk Anti-Human CD11c (3.9) Antibody
ICH1008-5mg 5 mg

Bulk Anti-Human CD11c (3.9) Antibody

Sign In for Pricing
View Details
Human NSE2 (NSMCE2) activation kit by CRISPRa
GA117272 1 Kit

Human NSE2 (NSMCE2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF405S conjugate, 0.1mg/mL
BNC040681-500 1x 500 µL

Human Kappa Light Chain (HP6053), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details