Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2048

UniProt

O28231

Expression Region

1-307

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKQMEKKSARLLAFLLALIMIGSVFAYMLSGGSAEHREVVYRLDDFREYVNWTPADPVY VQYYNLSYTSKLGSKDPLASMVTTDLQKLLIPAIFSRQVLEVTRGISQVMIVDFGETVPL YFVDAGMSKIYFAKEDEIKHGNFTLQVRRPGIALVSELSPLVVGYKPLVEKAVDTVEGNY PSFGNKTYSYLSRINGSFAYAFFAYGDVVKQWIRVGNESPADFFFEGYRYNFNNSSYEKV WAMHFEGNYFFGGMNESEKNFEYYKVQNFGDGLSVAVMEDKNFTKVVNARPNILTWQISF NNTQNES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL
BNC472098-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Relaxin 2 (RLN2) Rabbit Polyclonal Antibody
AP02205PU-N 100 µg

Relaxin 2 (RLN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pantothenic Acid Hemicalcium Salt
TRC-P190300-25G 25 g

Pantothenic Acid Hemicalcium Salt

Sign In for Pricing
View Details
GALNT6 (C-term) Rabbit Polyclonal Antibody
AP51771PU-N 400 µL

GALNT6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC49A3 activation kit by CRISPRa
GA113409 1 Kit

Human SLC49A3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mrpl53 (BC065995) Mouse Tagged ORF Clone
MG200542 10 µg

Mrpl53 (BC065995) Mouse Tagged ORF Clone

Sign In for Pricing
View Details