Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 1 (CBR1)

This Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 1 (CBR1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 1, EC= 1.6.2.2, Microsomal cytochrome b reductase

UniProt

Q1DWN4

Expression Region

1-308

Origin

Coccidioides immitis (strain RS) (Valley fever fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSWTSKENINGVYIPSALLIFGTTIIKKEWIAYATALAVVLSAWKLFSNKPRKVLNPTE FQNFVLKDKTIVSHNVCIYRFALPRPTDILGLPIGQHISLAATIPGQSKEIVRSYTPISS DDDAGYFDLLVKSYPQGNISKHLTTLRIGDKMKVRGPKGAMVYTPNMVRHIGMIAGGTGI TPMLQVIKAIIKGRPRNGGNDTTQIDLIFANVNPDDILLKEELDQLAKEDDAFRIYYVLN NPPEKWNGGVGFVTPDMIKAKLPAPAGDIKVLICGPPPMVSAMKKATESLGYKKANLVSK LEDQVFCF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF647 conjugate, 0.1mg/mL
BNC471009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details