Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatid maturation protein 1 (SPEM1)

This Recombinant Human Spermatid maturation protein 1 (SPEM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Spermatid maturation protein 1

UniProt

Q8N4L4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQV FHDTICEKEAPKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTR CAHCPVAWAPDTDDEKPHQYPAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIR FQPTVEERPLKTGIWSELGLRAYVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPA PTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEALSGCYPLASGSSTAEETSKN WVYRSLTGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2ORF89 Protein Lysate (Human) with C-Ha Tag
14445031 100 µg

C2ORF89 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Aup1 3'UTR Lenti-reporter-Luc Vector
12865084 1.0 µg

Aup1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Oryza nivara DNA-directed RNA polymerase subunit beta'(rpoC1), partial
MBS1444412 Inquire

Recombinant Oryza nivara DNA-directed RNA polymerase subunit beta'(rpoC1), partial

Sign In for Pricing
View Details
Benfotiamine
B3209-1G 1 g

Benfotiamine

Sign In for Pricing
View Details
GluR4, phosphorylated (S862) (Glutamate Receptor 4, GluR-4, GluR4, AMPA-selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4, GLUR4) discontinued
222976-01 50 µL

GluR4, phosphorylated (S862) (Glutamate Receptor 4, GluR-4, GluR4, AMPA-selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4, GLUR4) discontinued

Sign In for Pricing
View Details
GluR4, phosphorylated (S862) (Glutamate Receptor 4, GluR-4, GluR4, AMPA-selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4, GLUR4) discontinued
222976-02 100 µL

GluR4, phosphorylated (S862) (Glutamate Receptor 4, GluR-4, GluR4, AMPA-selective Glutamate Receptor 4, GluR-D, Glutamate Receptor Ionotropic, AMPA 4, GluA4, GRIA4, GLUR4) discontinued

Sign In for Pricing
View Details