Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatid maturation protein 1 (SPEM1)

This Recombinant Human Spermatid maturation protein 1 (SPEM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Spermatid maturation protein 1

UniProt

Q8N4L4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQV FHDTICEKEAPKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTR CAHCPVAWAPDTDDEKPHQYPAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIR FQPTVEERPLKTGIWSELGLRAYVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPA PTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEALSGCYPLASGSSTAEETSKN WVYRSLTGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger Protein 28 (ZFP28) Antibody
abx036686-01 100 µg

Zinc Finger Protein 28 (ZFP28) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 28 (ZFP28) Antibody
abx036686-02 1 mg

Zinc Finger Protein 28 (ZFP28) Antibody

Sign In for Pricing
View Details
CPD CRISPRa sgRNA lentivector (set of three targets)(Rat)
16743126 3x 1.0µg DNA

CPD CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Profilin 1 Antibody (OTI1D5) [Alexa Fluor 350]
NBP2-73605AF350 0.1 mL

Mouse Monoclonal Profilin 1 Antibody (OTI1D5) [Alexa Fluor 350]

Sign In for Pricing
View Details
EIF2A (Eukaryotic Translation Initiation Factor 2A, eIF-2A, 65kD Eukaryotic Translation Initiation Factor 2A, CDA02, MSTP004, MSTP089) (MaxLight 550)
MBS6211290-01 0.1 mL

EIF2A (Eukaryotic Translation Initiation Factor 2A, eIF-2A, 65kD Eukaryotic Translation Initiation Factor 2A, CDA02, MSTP004, MSTP089) (MaxLight 550)

Sign In for Pricing
View Details
EIF2A (Eukaryotic Translation Initiation Factor 2A, eIF-2A, 65kD Eukaryotic Translation Initiation Factor 2A, CDA02, MSTP004, MSTP089) (MaxLight 550)
MBS6211290-02 5x 0.1 mL

EIF2A (Eukaryotic Translation Initiation Factor 2A, eIF-2A, 65kD Eukaryotic Translation Initiation Factor 2A, CDA02, MSTP004, MSTP089) (MaxLight 550)

Sign In for Pricing
View Details