Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatid maturation protein 1 (SPEM1)

This Recombinant Human Spermatid maturation protein 1 (SPEM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Spermatid maturation protein 1

UniProt

Q8N4L4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQV FHDTICEKEAPKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTR CAHCPVAWAPDTDDEKPHQYPAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIR FQPTVEERPLKTGIWSELGLRAYVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPA PTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEALSGCYPLASGSSTAEETSKN WVYRSLTGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit
MBS9353804-01 48 Well

Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit
MBS9353804-02 96 Well

Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit
MBS9353804-03 5x 96 Well

Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit
MBS9353804-04 10x 96 Well

Canine Interleukin 10 Antibody (Anti-IL10) ELISA Kit

Sign In for Pricing
View Details
RASL10A Rabbit Polyclonal Antibody
orb581609 100 µL

RASL10A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP40 (h) -PR
sc-72750-PR 10 µM - 20 µL

ARHGAP40 (h) -PR

Sign In for Pricing
View Details