Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Cronobacter sakazakii p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A7MJB1

Expression Region

1-310

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLLTTKITRTAITVVLVVLAFIAIFRAWSFYTESPWTRDARFSADVVAIAPDVAGLITS VDVHDNQLVKKDQVLFTIDQPRYQKALEEAEADVAYYQALANEKRREAGRRNQLGVQAMS REEIDQANNVLQTVLHQLAKAEATRDLAKLDLQRTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVQAYMEETKLEGVRPGFRVEITPLGSNNVLHGTVDSVSAGVTNASSTR DAKGMATVDSNLEWVRLAQRVPVRIRLDKQPGNLYPAGTTATVVVTGERDRDRSQESAFN KLMHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-100 1x 100 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF647 conjugate, 0.1mg/mL
BNC471147-100 1x 100 µL

CD45RB (PTPRC/1147), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details