Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NEDD4 family-interacting protein 2 (Ndfip2)

This Recombinant Mouse NEDD4 family-interacting protein 2 (Ndfip2) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A

UniProt

Q91ZP6

Expression Region

1-311

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRSASDAELSAGAEGATGSEAAPPGDLGGRTRGGGRGSAAAAATTSTREAEGAERRGDTP ARKPDPEAGRMDHHQLGTGRYQVLHNEEDNSESSAVEQPSTSSLAAPTVEAAASAPALDP DSPPPYSSITVEAPTTSDTDVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAAAADAP QRNQEEDCTPRDDFSDVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAI CGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMA AAHRTRYFFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-OR5J2 Polyclonal Antibody
PAV2816 100 μL

Rabbit Anti-OR5J2 Polyclonal Antibody

Sign In for Pricing
View Details
Universal PGE2 ELISA Kit
E107027 1 Each

Universal PGE2 ELISA Kit

Sign In for Pricing
View Details
Dog/Canine A1-Acid Glycoprotein A1-AGP ELISA Kit
orb1176678 1x 96 Tests

Dog/Canine A1-Acid Glycoprotein A1-AGP ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri rplT Protein (aa 1-119) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9748-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri rplT Protein (aa 1-119) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
FANCD2 (Phospho-Ser222) Antibody
11965-01 50 µL

FANCD2 (Phospho-Ser222) Antibody

Sign In for Pricing
View Details
FANCD2 (Phospho-Ser222) Antibody
11965-02 100 µL

FANCD2 (Phospho-Ser222) Antibody

Sign In for Pricing
View Details