Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Magnesium transport protein CorA (corA)

This Recombinant Haemophilus influenzae Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

P44998

Expression Region

1-315

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINAFAINDSRLVRIDEDQTDLNTAIWLDLLEPTGEEREMLQEGLGQSLASFLELEDIEA SARFFEDEDGLHLHSFFYCEDEDNYADLASVAFTIRDGRLFTLRDRELPAFRLYRMRSRS QRLLECNSYEVLLDLFETKIEQLADVIENIYADLEELSRVILNGKQDEAFDEALNTLTEQ EDTSSKVRLCLMDTQRALGFLVRKTRLPTNQLEQAREILRDIESLQPHNESLFQKVNFLM QAAMGYINIEQNKIMKFFSVVSVMFLPATLVASTYGMNFDFMPELHFKYGYPMAIGLMIA AALTPYIYFRRKGWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF740 conjugate, 0.1mg/mL
BNC740746-100 1x 100 µL

CD5 (CD5/54/F6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF594 conjugate, 0.1mg/mL
BNC941372-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details