Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter crescentus Protease HtpX homolog (htpX)

This Recombinant Caulobacter crescentus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B8H051

Expression Region

1-316

Origin

Caulobacter crescentus (strain NA1000 / CB15N)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHFKTYMLLAGLTALFMGAGFLIGGATGMMIALVFALAMNAFSYWNADKIVLRTYGAVE VDESHPEPLIRNYVIDTVEMARSAGLPRPRITVIDSAQPNAFATGRDPDHAAVAASTGLL QLLTREEIRGVMAHELAHVKNRDTLVMTVTATIAGAISALANFAFFFGGSRDEEGNGGGL GGMIGAILIAILAPIAAMLVQMAISRAREYEADRIGAQIAGDSESLARALQKIEAYARGG YENVQAERNPATAHMFIINPLAGKGADNLFSTHPATHNRVEALMRLGVERGARRPVMAAT TSSSVPLSGERGGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), 0.2mg/mL
BNUB0333-100 1x 100 µL

CD8 (RIV11), 0.2mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details