Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 231 (TMEM231)

This Recombinant Human Transmembrane protein 231 (TMEM231) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Transmembrane protein 231

UniProt

Q9H6L2

Expression Region

1-316

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPT VRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHF KLELPLQSTEHVLGVQLILTFSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQ KQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAAD APFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQVVTTI PVTVTPRGDLCKEHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]
CF807397 100 µg

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

Sign In for Pricing
View Details
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]
CF810111 100 µg

ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]

Sign In for Pricing
View Details
UBE4B Recombinant Rabbit Monoclonal Antibody [JE55-76]
ET7111-11 100 µL

UBE4B Recombinant Rabbit Monoclonal Antibody [JE55-76]

Sign In for Pricing
View Details
Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit
RD-FPR2-Hu-01 96 Tests

Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit

Sign In for Pricing
View Details
Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit
RD-FPR2-Hu-02 48 Tests

Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit

Sign In for Pricing
View Details
Resp18 Mouse Gene Knockout Kit (CRISPR)
KN514674 1 Kit

Resp18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details