Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metaxin-1 (Mtx1)

This Recombinant Mouse Metaxin-1 (Mtx1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Metaxin-1, Mitochondrial outer membrane import complex protein 1

UniProt

P47802

Expression Region

1-317

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPMELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSD GKVITVPDKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHKSENEEELEKELYQEARECLTL LSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILNL YFPRDGDEVPLPRQTPAAPETEEEPYRRRTQILSVLAGLAAMVGYALLSGIVSIQRTSPA RAPGTRALGLAEEDEED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Wash Buffer, 10X
651 500 mL

ELISA Wash Buffer, 10X

Sign In for Pricing
View Details
Recombinant Human CRHBP Protein (His Tag)
PKSH032283-01 10 µg

Recombinant Human CRHBP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CRHBP Protein (His Tag)
PKSH032283-02 50 µg

Recombinant Human CRHBP Protein (His Tag)

Sign In for Pricing
View Details
1,4-Cyclohexanedione Monoethylene Acetal
TRC-C987955-5G 5 g

1,4-Cyclohexanedione Monoethylene Acetal

Sign In for Pricing
View Details
AK5 Antibody
KC-30233-01 50 μL

AK5 Antibody

Sign In for Pricing
View Details
AK5 Antibody
KC-30233-02 100 µL

AK5 Antibody

Sign In for Pricing
View Details