Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metaxin-1 (Mtx1)

This Recombinant Mouse Metaxin-1 (Mtx1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Metaxin-1, Mitochondrial outer membrane import complex protein 1

UniProt

P47802

Expression Region

1-317

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPMELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSD GKVITVPDKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHKSENEEELEKELYQEARECLTL LSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILNL YFPRDGDEVPLPRQTPAAPETEEEPYRRRTQILSVLAGLAAMVGYALLSGIVSIQRTSPA RAPGTRALGLAEEDEED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipoprotein Lipase Antibody
KC-2573-01 50 μL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-2573-02 100 µL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details
Lipoprotein Lipase Antibody
KC-2573-03 1 mL

Lipoprotein Lipase Antibody

Sign In for Pricing
View Details
25-Hydroxyvitamin D3 3-Hemisuccinate-13C4 (90%)
TRC-H995857-2.5MG 2.5 mg

25-Hydroxyvitamin D3 3-Hemisuccinate-13C4 (90%)

Sign In for Pricing
View Details
Ethylene Urea-d4
TRC-E917782-10MG 10 mg

Ethylene Urea-d4

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF647 conjugate, 0.1mg/mL
BNC471757-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details