Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SURF1-like protein (sft-1)

This Recombinant SURF1-like protein (sft-1) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

SURF1-like protein

UniProt

Q9N5N8

Expression Region

1-323

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLPAAAFARILVVSRQRLFNTRIIHTSGSGYSITQCRFYKTTPCLTHKQSQILDLDAPK SRENREKDGGKSKKSKKSIKWSTGSVLMLTIPVFAFSLGIWQTFRLKWKLDLIEHLKGRL NQTAQELPEDLSCESLEPLEYCRVTVTGEFLHEKEFIISPRGRFDPGKKTSAAAGSMLSE NEMSSHGGHLITPFRLKNSGKIILINRGWLPSFYFDPETRQKTNPRGTLTLPAIVRKTEK RPQFVGQNVPEQGVWYYRDLNQMAKHYGTEPVLLDAAYETTVPGGPIGGQTNINVRNEHL NYLTTWFTLTLVTMLMWIHKFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: OTI4H6]
CF805190 100 µg

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: OTI4H6]

Sign In for Pricing
View Details
Human TPBGL activation kit by CRISPRa
GA119312 1 Kit

Human TPBGL activation kit by CRISPRa

Sign In for Pricing
View Details
MitoLite™ Blue FX490
22674-AAT 500 Tests

MitoLite™ Blue FX490

Sign In for Pricing
View Details
Zfp654 Mouse Gene Knockout Kit (CRISPR)
KN519927 1 Kit

Zfp654 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IFNA21 activation kit by CRISPRa
GA102338 1 Kit

Human IFNA21 activation kit by CRISPRa

Sign In for Pricing
View Details
PSMD5 (NM_005047) Human Over-expression Lysate
LC401563 20 µg

PSMD5 (NM_005047) Human Over-expression Lysate

Sign In for Pricing
View Details