Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SURF1-like protein (sft-1)

This Recombinant SURF1-like protein (sft-1) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

SURF1-like protein

UniProt

Q9N5N8

Expression Region

1-323

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLPAAAFARILVVSRQRLFNTRIIHTSGSGYSITQCRFYKTTPCLTHKQSQILDLDAPK SRENREKDGGKSKKSKKSIKWSTGSVLMLTIPVFAFSLGIWQTFRLKWKLDLIEHLKGRL NQTAQELPEDLSCESLEPLEYCRVTVTGEFLHEKEFIISPRGRFDPGKKTSAAAGSMLSE NEMSSHGGHLITPFRLKNSGKIILINRGWLPSFYFDPETRQKTNPRGTLTLPAIVRKTEK RPQFVGQNVPEQGVWYYRDLNQMAKHYGTEPVLLDAAYETTVPGGPIGGQTNINVRNEHL NYLTTWFTLTLVTMLMWIHKFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Tendon
CS627121 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A4]
TA800087AM 100 µL

TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A4]

Sign In for Pricing
View Details
FBXO46 (NM_001080469) Human Over-expression Lysate
LC420726 20 µg

FBXO46 (NM_001080469) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS701778 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Xpo6 Mouse Gene Knockout Kit (CRISPR)
KN519516 1 Kit

Xpo6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARAF Antibody
KC-719-01 50 μL

ARAF Antibody

Sign In for Pricing
View Details