Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cell cycle control protein 50A (Tmem30a)

This Recombinant Rat Cell cycle control protein 50A (Tmem30a) spans the amino acid sequence from region 2-328.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q6AY41

Expression Region

2-328

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKEC EPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFR NPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYR LIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGS ISFLLGVVLLVINHKYRNSSNTADITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR562108 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
EIF2B3 (NM_001166588) Human Recombinant Protein
TP761225 50 µg

EIF2B3 (NM_001166588) Human Recombinant Protein

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL
BNC881731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAD23B Polyclonal Antibody
E-AB-52631-01 20 µL

RAD23B Polyclonal Antibody

Sign In for Pricing
View Details