Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cell cycle control protein 50A (Tmem30a)

This Recombinant Rat Cell cycle control protein 50A (Tmem30a) spans the amino acid sequence from region 2-328.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q6AY41

Expression Region

2-328

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKEC EPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFR NPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYR LIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGS ISFLLGVVLLVINHKYRNSSNTADITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 3 (M3.1), CF568 conjugate, 0.1mg/mL
BNC680990-500 1x 500 µL

Mucin 3 (M3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), CF740 conjugate, 0.1mg/mL
BNC741200-100 1x 100 µL

EGFR (GFR1195 + 31G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MVK Rabbit Monoclonal Antibody [Clone ID: R08-6D3]
TA421891 100 µL

MVK Rabbit Monoclonal Antibody [Clone ID: R08-6D3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505953 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
SGK196 (POMK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA804718AM 100 µL

SGK196 (POMK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details
ROR2 (ROR2/1912), CF594 conjugate, 0.1mg/mL
BNC941912-100 1x 100 µL

ROR2 (ROR2/1912), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details