Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Succinoglycan biosynthesis protein exoA (exoA)

This Recombinant Rhizobium meliloti Succinoglycan biosynthesis protein exoA (exoA) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Succinoglycan biosynthesis protein exoA, EC= 2.4.-.-

UniProt

P33691

Expression Region

1-330

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDELTSTSSLIVIPCLNEASHIEALIEKLRPSLTPLNARVVIADGGSTDGTREIARRL ATEDPRVLFLDNPKRIQSAAVNRAVAELGAGSDYLIRIDAHGTYPDDYCERLVEDALATG ADSVVVAMQTVGFSTFQKATAFAQNSKLGNGGSKHRTGAVGHWAEHGHHALMRIEAFKAV GGYDESFSHNEDAELDYRLGKAGYRIWMTDKTSMVYYPRAKLVPLFWQYFGYGRGRAKNF LKHRAMPGLRQMLPLAVAPIAFGALLAIVNWMAVVPVGVWAAACLGYGVWMALGQRNPYG PLAAVAAMVMHLAWSAGFWRELLDFRRRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL
BNC470763-500 1x 500 µL

CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF405S conjugate, 0.1mg/mL
BNC041025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF488A conjugate, 0.1mg/mL
BNC880639-500 1x 500 µL

CD31 / PECAM-1 (JC/70A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF594 conjugate, 0.1mg/mL
BNC940715-100 1x 100 µL

Thymidylate Synthase (TMS715), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details