Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage II sporulation protein B (spoIIB)

This Recombinant Bacillus subtilis Stage II sporulation protein B (spoIIB) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Stage II sporulation protein B

UniProt

P37575

Expression Region

1-332

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRKNKKNSKAAEKALKVTINGKEETVYEQETPETEANKSMTFSNWEEKRQAEQEVAAS QEHPDEDEFNWDSEEDKVFKEDPKVVPPFQKKKTKLYAKGKTGAAKPVKRVAATIAFAAV IGTGLGLFALNISGNKEASAPASLEDSLGSQTAKAGDTSADKQTSGAEKQAAQTEGTYKT YAVQAGKFSNEKGAETLTEQLTEKGYSAVSLSKDDGYTYVIAGLASEKEVSQQLGQVLID SDFEAWGGKELSLSIESDMTDSFKETAELAAKAILDEDITKASVEKIEKSLGETKASETG EKKAILQALKELEDPSAEAGWKAQQELLAVVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGC5 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF807812 100 µg

PCDHGC5 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

Sign In for Pricing
View Details
UBXN6 Rabbit Polyclonal Antibody
TA362487 100 µL

UBXN6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2S,4R)-1-(2-Aminoacetyl)-4-benzamidopyrrolidine-2-carboxylicacid-D5
TRC-A377460-10MG 10 mg

(2S,4R)-1-(2-Aminoacetyl)-4-benzamidopyrrolidine-2-carboxylicacid-D5

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), Biotin conjugate, 0.1mg/mL
BNCB2477-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Slc20a2 activation kit by CRISPRa
GA203945 1 Kit

Mouse Slc20a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NEURL3 activation kit by CRISPRa
GA114261 1 Kit

Human NEURL3 activation kit by CRISPRa

Sign In for Pricing
View Details