Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 9 Envelope glycoprotein I (GI)

This Recombinant Cercopithecine herpesvirus 9 Envelope glycoprotein I (GI) spans the amino acid sequence from region 21-353.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI, Membrane glycoprotein 1

UniProt

Q04547

Expression Region

21-353

Origin

Cercopithecine herpesvirus 9 (strain DHV) (CeHV-9) (Simian varicella virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIQCAAAIIYRGNYISLYVNSSATSIFLKGNNNDASIRGRFLFIGDQFPVTNTYNVTVEL LHVNQTTLCLQPLYRVMYGECPRIRTGAIIACRVKRSWHYENATQLTDPNVEIIFKMNNT KVEDAGIYLLVVQLDYTSLFDIFFVSLNVYPKQDTSNEDVNYFPPVYSPSHILNTFKICH KFPVHNGMEQSILQHIVTSDVDTETENLSWQKDDLGSTQKPRKNFNPDVKVNVTHETRKT LMESSADVFMIAVPITASLLVILAIIIVVTVGIYRRRSSEKRKIYRPKRTKEQASTEKRE RSESDVLLEAAVARLETIQEENPPHSVINPFTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Helicobacter pylori Antibody
V8329-100UG 100 µg

Helicobacter pylori Antibody

Sign In for Pricing
View Details
IPO4 Polyclonal Antibody
E-AB-11331-01 20 µL

IPO4 Polyclonal Antibody

Sign In for Pricing
View Details
IPO4 Polyclonal Antibody
E-AB-11331-02 60 µL

IPO4 Polyclonal Antibody

Sign In for Pricing
View Details
IPO4 Polyclonal Antibody
E-AB-11331-03 120 µL

IPO4 Polyclonal Antibody

Sign In for Pricing
View Details
IPO4 Polyclonal Antibody
E-AB-11331-04 200 µL

IPO4 Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-,  5nm
GP-8201-5 1 mL

Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-, 5nm

Sign In for Pricing
View Details