Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 9 Envelope glycoprotein I (GI)

This Recombinant Cercopithecine herpesvirus 9 Envelope glycoprotein I (GI) spans the amino acid sequence from region 21-353.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI, Membrane glycoprotein 1

UniProt

Q04547

Expression Region

21-353

Origin

Cercopithecine herpesvirus 9 (strain DHV) (CeHV-9) (Simian varicella virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIQCAAAIIYRGNYISLYVNSSATSIFLKGNNNDASIRGRFLFIGDQFPVTNTYNVTVEL LHVNQTTLCLQPLYRVMYGECPRIRTGAIIACRVKRSWHYENATQLTDPNVEIIFKMNNT KVEDAGIYLLVVQLDYTSLFDIFFVSLNVYPKQDTSNEDVNYFPPVYSPSHILNTFKICH KFPVHNGMEQSILQHIVTSDVDTETENLSWQKDDLGSTQKPRKNFNPDVKVNVTHETRKT LMESSADVFMIAVPITASLLVILAIIIVVTVGIYRRRSSEKRKIYRPKRTKEQASTEKRE RSESDVLLEAAVARLETIQEENPPHSVINPFTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SNIP1 Antibody
RN-14942-01 50 μL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
Recombinant SNIP1 Antibody
RN-14942-02 100 µL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
Recombinant SNIP1 Antibody
RN-14942-03 1 mL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
Human TRA16 (NR2C2AP) activation kit by CRISPRa
GA114943 1 Kit

Human TRA16 (NR2C2AP) activation kit by CRISPRa

Sign In for Pricing
View Details
1-Oxa-4-azaspiro[5.5]undecan-9-amine HCl Salt
TRC-O477750-50MG 50 mg

1-Oxa-4-azaspiro[5.5]undecan-9-amine HCl Salt

Sign In for Pricing
View Details
Adam3 Mouse Gene Knockout Kit (CRISPR)
KN500834 1 Kit

Adam3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details