Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mesoderm-specific transcript homolog protein (MEST)

This Recombinant Human Mesoderm-specific transcript homolog protein (MEST) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Mesoderm-specific transcript homolog protein, EC= 3.-.-.-, Paternally-expressed gene 1 protein

UniProt

Q5EB52

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP85L Antibody - N-terminal region : HRP (ARP68055_P050-HRP)
ARP68055_P050-HRP 100 µL

CEP85L Antibody - N-terminal region : HRP (ARP68055_P050-HRP)

Sign In for Pricing
View Details
SRC Rabbit Polyclonal Antibody (BF750)
orb1583996 100 µL

SRC Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila plsX Protein (aa 1-342)
VAng-Lsx3821-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila plsX Protein (aa 1-342)

Sign In for Pricing
View Details
UAP56 (DDX39B) Human Over-expression Lysate
orb1352280 100 µg

UAP56 (DDX39B) Human Over-expression Lysate

Sign In for Pricing
View Details
Mitochondrial Marker (MTC754), 0.2mg/mL
BNUB0754-100 1x 100 µL

Mitochondrial Marker (MTC754), 0.2mg/mL

Sign In for Pricing
View Details
NEU3 Rabbit Polyclonal Antibody (Cy3)
orb2938147 100 µg

NEU3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details