Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mesoderm-specific transcript homolog protein (MEST)

This Recombinant Human Mesoderm-specific transcript homolog protein (MEST) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Mesoderm-specific transcript homolog protein, EC= 3.-.-.-, Paternally-expressed gene 1 protein

UniProt

Q5EB52

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 17A (IL17A) Antibody
abx170294-01 100 µL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
Interleukin 17A (IL17A) Antibody
abx170294-02 200 µL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
Interleukin 17A (IL17A) Antibody
abx170294-03 1 mL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
anti-ITGB3/CD61 (Phospho-Tyr785)
LF-PA20242 100 ul

anti-ITGB3/CD61 (Phospho-Tyr785)

Sign In for Pricing
View Details
ZSCAN2 Protein Vector (Mouse) (pPM-C-His)
PV251101 500 ng

ZSCAN2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
FTLP11 3'UTR Luciferase Stable Cell Line
TU008360 1.0 mL

FTLP11 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details