Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4 (ALIS4)

This Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4 (ALIS4) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Putative ALA-interacting subunit 4, AtALIS4

UniProt

Q9SA35

Expression Region

1-336

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTKKHNLLANFASSDSRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQG VIEIVDRYDTDCIPLSSRDNKVRYIQGLEDKRCNRTITVTKTMKNPVYVYYQLENYYQNH RRYVKSRQDGQLRSPKDEHETKSCAPEDTLGGQPIVPCGLVAWSLFNDTYDFTRNNQKLP VNKKDISWKSDRESKFGKNVFPKNFQKGSLIGGKSLDQDIPLSEQEDLIVWMRTAALPTF RKLYGKIDTDLQAGDTIKVLLQNNYNTYSFNGKKKLVLSTTSWLGGRNDFLGIAYLTVGS ICLFLAVSFSVLYLAKPRQLGDPSYLSWNRSAGGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3096-07 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Transmembrane protein 200A Recombinant Mouse Monoclonal Antibody [4-B3-R]
HA601191 100 µL

Transmembrane protein 200A Recombinant Mouse Monoclonal Antibody [4-B3-R]

Sign In for Pricing
View Details
MBNL3 (NM_001170701) Human Over-expression Lysate
LY432854 100 µg

MBNL3 (NM_001170701) Human Over-expression Lysate

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]
TA800788AM 100 µL

CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]

Sign In for Pricing
View Details
DAPK2 (Ab-318) Antibody
8B0899-AAT 50 µg

DAPK2 (Ab-318) Antibody

Sign In for Pricing
View Details
Human ATP6V0E2 activation kit by CRISPRa
GA115910 1 Kit

Human ATP6V0E2 activation kit by CRISPRa

Sign In for Pricing
View Details