Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4 (ALIS4)

This Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4 (ALIS4) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Putative ALA-interacting subunit 4, AtALIS4

UniProt

Q9SA35

Expression Region

1-336

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTKKHNLLANFASSDSRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQG VIEIVDRYDTDCIPLSSRDNKVRYIQGLEDKRCNRTITVTKTMKNPVYVYYQLENYYQNH RRYVKSRQDGQLRSPKDEHETKSCAPEDTLGGQPIVPCGLVAWSLFNDTYDFTRNNQKLP VNKKDISWKSDRESKFGKNVFPKNFQKGSLIGGKSLDQDIPLSEQEDLIVWMRTAALPTF RKLYGKIDTDLQAGDTIKVLLQNNYNTYSFNGKKKLVLSTTSWLGGRNDFLGIAYLTVGS ICLFLAVSFSVLYLAKPRQLGDPSYLSWNRSAGGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon
CB511067 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
HLA Class 1 ABC Mouse Monoclonal Antibody [11C2]
EM1801-10 100 µL

HLA Class 1 ABC Mouse Monoclonal Antibody [11C2]

Sign In for Pricing
View Details
Moesin (rMSN/492), 0.2mg/mL
BNUB2307-500 1x 500 µL

Moesin (rMSN/492), 0.2mg/mL

Sign In for Pricing
View Details
ITPKA (C-term) Rabbit Polyclonal Antibody
AP15175PU-N 400 µL

ITPKA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD99 Rabbit Monoclonal Antibody
TA422921 100 µL

CD99 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
XFD700 NHS Ester
1836-AAT 1 mg

XFD700 NHS Ester

Sign In for Pricing
View Details