Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2)

This Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF2, Gene 2 protein

UniProt

P15893

Expression Region

1-337

Origin

Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFVLQCIYFVWWLWKNIF YQLNSFGLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFGNRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVIKKGFNFFNRFFIMQIGIFQDITDYEIWKT KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIVNKKEYY WSEITKLSVKERLELFDIDILKKNLKPKKEKGNGKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophanyl tRNA synthetase / WRS Recombinant Rabbit Monoclonal Antibody [JE48-08]
ET7109-73 100 µL

Tryptophanyl tRNA synthetase / WRS Recombinant Rabbit Monoclonal Antibody [JE48-08]

Sign In for Pricing
View Details
Annexin V-PE/Cyanine7/7-AAD Apoptosis Kit
E-CK-A228-01 20 Assays

Annexin V-PE/Cyanine7/7-AAD Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-PE/Cyanine7/7-AAD Apoptosis Kit
E-CK-A228-02 100 Assays

Annexin V-PE/Cyanine7/7-AAD Apoptosis Kit

Sign In for Pricing
View Details
Ferredoxin Reductase (FDXR) Rabbit Polyclonal Antibody
TA370648 100 µL

Ferredoxin Reductase (FDXR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL
BNC942312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-(2-Chlorophenyl)-2,4-dihydro-8-nitro-1H-imidazo[1,2-a][1,4]benzodiazepin-1-one
TRC-C609885-25MG 25 mg

6-(2-Chlorophenyl)-2,4-dihydro-8-nitro-1H-imidazo[1,2-a][1,4]benzodiazepin-1-one

Sign In for Pricing
View Details