Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2)

This Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF2, Gene 2 protein

UniProt

P15893

Expression Region

1-337

Origin

Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFVLQCIYFVWWLWKNIF YQLNSFGLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFGNRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVIKKGFNFFNRFFIMQIGIFQDITDYEIWKT KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIVNKKEYY WSEITKLSVKERLELFDIDILKKNLKPKKEKGNGKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Epithelial Neutrophil Activating Peptide 78 (ENA78) ELISA Kit
RDR-ENA78-Hu-01 96 Tests

Human Epithelial Neutrophil Activating Peptide 78 (ENA78) ELISA Kit

Sign In for Pricing
View Details
Human Epithelial Neutrophil Activating Peptide 78 (ENA78) ELISA Kit
RDR-ENA78-Hu-02 48 Tests

Human Epithelial Neutrophil Activating Peptide 78 (ENA78) ELISA Kit

Sign In for Pricing
View Details
6-Chloro-D,L-tryptophan
TRC-C423205-500MG 500 mg

6-Chloro-D,L-tryptophan

Sign In for Pricing
View Details
CTRP6 (C1QTNF6) Rabbit Polyclonal Antibody
AP07682PU-N 50 µg

CTRP6 (C1QTNF6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IPG -1 TMA+ Salt - yellow -green fluorescent potassium indicator
3043F 10x 50 µg

IPG -1 TMA+ Salt - yellow -green fluorescent potassium indicator

Sign In for Pricing
View Details
Lipin 1 (LPIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]
TA806417AM 100 µL

Lipin 1 (LPIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details