Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2)

This Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF2, Gene 2 protein

UniProt

P15893

Expression Region

1-337

Origin

Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFVLQCIYFVWWLWKNIF YQLNSFGLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFGNRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVIKKGFNFFNRFFIMQIGIFQDITDYEIWKT KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIVNKKEYY WSEITKLSVKERLELFDIDILKKNLKPKKEKGNGKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMV-p65 (CMV101), 1mg/mL
BNUM0101-50 1x 50 µL

CMV-p65 (CMV101), 1mg/mL

Sign In for Pricing
View Details
MMP1 Antibody
KC-3194-01 50 μL

MMP1 Antibody

Sign In for Pricing
View Details
MMP1 Antibody
KC-3194-02 100 µL

MMP1 Antibody

Sign In for Pricing
View Details
MMP1 Antibody
KC-3194-03 1 mL

MMP1 Antibody

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL
BNUB2540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL

Sign In for Pricing
View Details
(1S,3R)-Inpyrfluxam-hydroxy
TRC-I618390-25MG 25 mg

(1S,3R)-Inpyrfluxam-hydroxy

Sign In for Pricing
View Details