Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Monopolar spindle protein 2 (MPS2)

This Recombinant Ashbya gossypii Monopolar spindle protein 2 (MPS2) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Monopolar spindle protein 2

UniProt

Q755A9

Expression Region

1-338

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWREEAREQLRRGRCCFAAASVVSTAKHNKSLGNCTHGSGVMTEAEGILNNVWDAVDSKQ QGFIYAKDMPDLVGRFGQFLAQSLTSRANDEAIAAFASEKPFYKLDKEQFKSTFQTLVGT SLQTAVELAGHGEPRPRLFGAIRRASATGDEQAREELERKSAELSRVRDELDEWKSKYQF LEREFLFYQTHHENSVDSTQHEFIISEMKRTIEEQTRMIGQLRRQVQGGTQVLARAGKRA SPVDVFMYVSRQGLLLLMRMPKAAFLLLLLGYFVWYTVMGGAVQGPDPSVALPEPPKQPW WEQNNIISALYWYLTDTFEPSQRINDTVNDNYNSLFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atezolizumab Biosimilar - Research Grade: APC
ICH4018APC-50ug 50 µg

Atezolizumab Biosimilar - Research Grade: APC

Sign In for Pricing
View Details
Bis(2-butoxyethyl) 2-(3-Hydroxybutoxy)ethyl Phosphate Triester
TRC-B415220-10MG 10 mg

Bis(2-butoxyethyl) 2-(3-Hydroxybutoxy)ethyl Phosphate Triester

Sign In for Pricing
View Details
Sulfametrole
TRC-S699025-10MG 10 mg

Sulfametrole

Sign In for Pricing
View Details
Recombinant GABA A Receptor alpha 1 Monoclonal Antibody
AN301811L-01 50 µL

Recombinant GABA A Receptor alpha 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GABA A Receptor alpha 1 Monoclonal Antibody
AN301811L-02 100 µL

Recombinant GABA A Receptor alpha 1 Monoclonal Antibody

Sign In for Pricing
View Details
Mini Centrifuge BCMI-503
BCMI-503 1 Unit

Mini Centrifuge BCMI-503

Sign In for Pricing
View Details