Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Monopolar spindle protein 2 (MPS2)

This Recombinant Ashbya gossypii Monopolar spindle protein 2 (MPS2) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Monopolar spindle protein 2

UniProt

Q755A9

Expression Region

1-338

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWREEAREQLRRGRCCFAAASVVSTAKHNKSLGNCTHGSGVMTEAEGILNNVWDAVDSKQ QGFIYAKDMPDLVGRFGQFLAQSLTSRANDEAIAAFASEKPFYKLDKEQFKSTFQTLVGT SLQTAVELAGHGEPRPRLFGAIRRASATGDEQAREELERKSAELSRVRDELDEWKSKYQF LEREFLFYQTHHENSVDSTQHEFIISEMKRTIEEQTRMIGQLRRQVQGGTQVLARAGKRA SPVDVFMYVSRQGLLLLMRMPKAAFLLLLLGYFVWYTVMGGAVQGPDPSVALPEPPKQPW WEQNNIISALYWYLTDTFEPSQRINDTVNDNYNSLFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stmn4 Mouse Gene Knockout Kit (CRISPR)
KN516892 1 Kit

Stmn4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SKA3 (NM_145061) Human Recombinant Protein
TP322931 20 µg

SKA3 (NM_145061) Human Recombinant Protein

Sign In for Pricing
View Details
α, ω-Bis-Bromo PEG
112000-1.1G 1 g

α, ω-Bis-Bromo PEG

Sign In for Pricing
View Details
4-Deacetyl-7-(triethylsilyl)baccatin III
TRC-D198223-10MG 10 mg

4-Deacetyl-7-(triethylsilyl)baccatin III

Sign In for Pricing
View Details
Propoxycarbazone Sodium Salt
TRC-P831308-500MG 500 mg

Propoxycarbazone Sodium Salt

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), Biotin conjugate, 0.1mg/mL
BNCB3605-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details