Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0909 (Mb0909)

This Recombinant Uncharacterized protein Mb0909 (Mb0909) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0909

UniProt

P0A5D6

Expression Region

1-340

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKL3/NKIAMRE Rabbit Polyclonal Antibody (PE-Cy5)
orb878239 100 µL

CDKL3/NKIAMRE Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Anti-NME3 Antibody
A08517 100 µL

Anti-NME3 Antibody

Sign In for Pricing
View Details
MTRNR2L6 3'UTR GFP Stable Cell Line
TU064933 1.0 mL

MTRNR2L6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Klhl6 shRNA (UAS) - Lentiviral mouse Klhl6 shRNA (UAS) (25)
GTR15210521 1 Vial

Lentiviral mouse Klhl6 shRNA (UAS) - Lentiviral mouse Klhl6 shRNA (UAS) (25)

Sign In for Pricing
View Details
Ascl2 3'UTR GFP Stable Cell Line
TU250976 1.0 mL

Ascl2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103)
132627 100 µg

RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103)

Sign In for Pricing
View Details