Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 1 (Skint1)

This Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 1 (Skint1) spans the amino acid sequence from region 24-364.

Product Specifications

Product Name Alternative

Selection and upkeep of intraepithelial T-cells protein 1, Skint-1, Immunoglobulin-like and transmembrane domain-containing protein expressed in skin and thymus protein 1

UniProt

A7TZE6

Expression Region

24-364

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSEPFIVNGLEGPVLASLGGNLELSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMF GEIISKYVERTELLKDGIGEGKVTLRIFNVTVDDDGSYHCVFKDGDFYEEHITEVKITAI NLQVQIHVHPPNTKGVIVECHSGGWFPRPLMQWRDRRGEVIPAASKSHSQGRDKLFNMKI SLLISESFFQKVICCLQNPLTGQEERTSVILSDAFFSWNRIWKMILGIILSMMVVSIFVF SCLLHHEHKVCKWKWDAPWIKGLLIMTSSMVTVVLVMVYLHMKQRVPVSDVHFELDTLWV EDISVILCSLMVPATMLVSYTYFRLKDWCQHNHAQRVFTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details