Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q49VK4

Expression Region

1-342

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANLKWFFIFLRSRIYWILWLLFLHFIFLGIAYLDYDISVYSILYIIILNIGLSVLFLIF TYLKEVKFYKHLDENIEPEALKHKSLADTPFQQEMVNYLYGQITNQKALVTHQKQQIQST EAALTDFVHDIKTPVTAMKLLIEKEQDLSRKHALLYEWSRINDMLDRQLFLTRLEYQNKD MYFEHVPLKRLVIEEIQITRYISQSKGIGYDLDFEDTLNVYTDTKWCRMMIRQVLSNAVK YSEESMIHIRALKESRHVVLEIKDEGKGISEKDLPRIFDKGFTSTSNRNNTISSGLGLYL VNHVKEKLSICVRIHSELDKGTVVKFIFPNQNEIVAKLSQNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi-Well Plate
KF05US-9-NS 50 Pack/Case

Multi-Well Plate

Sign In for Pricing
View Details
SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5C8]
CF809808 100 µg

SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5C8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS807329 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
N Cadherin (CDH2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]
TA803323AM 100 µL

N Cadherin (CDH2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]

Sign In for Pricing
View Details
Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG
1310000-4-32.500MG 500 mg

Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG

Sign In for Pricing
View Details
Acidic Calponin (CNN3) (N-term) Rabbit Polyclonal Antibody
AP17171PU-N 400 µL

Acidic Calponin (CNN3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details