Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Cell wall integrity and stress response component 1 (wsc1)

This Recombinant Schizosaccharomyces pombe Cell wall integrity and stress response component 1 (wsc1) spans the amino acid sequence from region 30-374.

Product Specifications

Product Name Alternative

Cell wall integrity and stress response component 1

UniProt

P87179

Expression Region

30-374

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DMNTQYGCYLVDSSLTEQGTFTYLDPAYCYNNICGGSDNIAFVAIRNNQCYCGSTLTATE VSSSLCTTPCPGYGSLMCGGDLYWSVYLTGNGVLQTTVSSSSVSSTTSSSSSSSPSSSST TTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVP ITSSTSSSHSSSSSSSSSSSSSSRPSSSSSFITTMSSSTFISTVTVTPSSSSSSTSSEVP SSTAALALNASKASNHTSLNAGAIVGIVIGCVAFAVVMALCIFLYFYFRRFKIRMSDSAN EGKYPSYASELDSRLDPAMMNRKSSESLADSQDYSRKILRVTNLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL
BNC042540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details