Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q5HH23

Expression Region

20-366

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf35 (SETD9) Human qPCR Primer Pair (NM_153706)
HP218193 200 Reactions

C5orf35 (SETD9) Human qPCR Primer Pair (NM_153706)

Sign In for Pricing
View Details
RFC3 Mouse Monoclonal Antibody [Clone ID: OTI4A7]
CF811875 100 µg

RFC3 Mouse Monoclonal Antibody [Clone ID: OTI4A7]

Sign In for Pricing
View Details
PSME1 Recombinant Rabbit Monoclonal Antibody [JU60-33]
ET7106-98 100 µL

PSME1 Recombinant Rabbit Monoclonal Antibody [JU60-33]

Sign In for Pricing
View Details
CNAP1 (NCAPD2) Rabbit Polyclonal Antibody
TA378949 100 µL

CNAP1 (NCAPD2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MRPL20 activation kit by CRISPRa
GA110480 1 Kit

Human MRPL20 activation kit by CRISPRa

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (CLH2), CF640R conjugate, 0.1mg/mL
BNC400897-100 1x 100 µL

Mucin 5AC (MUC5AC) (CLH2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details