Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q7A6V4

Expression Region

1-351

Origin

Staphylococcus aureus (strain N315)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2A Antibody
KC-162-01 50 μL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-162-02 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-162-03 1 mL

CDKN2A Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Glia Fibrillary Acidic Protein,  5nm
GM-33-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Glia Fibrillary Acidic Protein, 5nm

Sign In for Pricing
View Details
trans,cis-Sorbic acid
TRC-S676894-50MG 50 mg

trans,cis-Sorbic acid

Sign In for Pricing
View Details
Human CXCL17 Antibody Pair Set
E-KAB-0542 50 µL & 100 µg

Human CXCL17 Antibody Pair Set

Sign In for Pricing
View Details