Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cydia pomonella granulosis virus Occlusion-derived virus envelope protein E56 (odv-e56)

This Recombinant Cydia pomonella granulosis virus Occlusion-derived virus envelope protein E56 (odv-e56) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

Q66209

Expression Region

1-355

Origin

Cydia pomonella granulosis virus (isolate Mexico/1963) (CpGV) (Cydia pomonella granulovirus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFRGLRRTNKVYNDPSGFITDHAQLIRNQTPAGFNLNNPTTMGLANGTYVPGYNINGA FISNTNVNTVLRNNDVVGMRQLFPDASNNQMNGLTNLRRADNIPDATLHGLQTRKNGVKT SHPETAVRDRVGVENALAQNPRLADYLRGAGYVTLFGVSVYLVINVADLVSSIVEALNRT GGSWYYRGNNGGDNFSNIDACVLRYRSCGMSLADIDEFVCELDPHDPNNVDPLLSFDEAR NFCNGYSLAAEGSVCRGSDTNADPSTLQYLDISELEPNQTVQCVEPYDFGDLIGDLGLDW LLGENGFVTASSNSLTSVSNNFTTILLVIGGILLLTFIGFVIFKVVNRSSNNNTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-100 1x 100 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF647 conjugate, 0.1mg/mL
BNC471384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF405S conjugate, 0.1mg/mL
BNC040684-100 1x 100 µL

CD68 (C68/684), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL
BNC942713-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF488A conjugate, 0.1mg/mL
BNC881692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details