Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 UPF0283 membrane protein BMEI0952 (BMEI0952)

This Recombinant Brucella melitensis biotype 1 UPF0283 membrane protein BMEI0952 (BMEI0952) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

UPF0283 membrane protein BMEI0952

UniProt

Q8YH52

Expression Region

1-357

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRSIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVMQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isobutanamidoxime
TRC-I789100-5G 5 g

Isobutanamidoxime

Sign In for Pricing
View Details
PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP02657PU-N 100 µL

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Neural tissue
CS709201 5x 5 µm

Tissue FFPE Sections, Neural tissue

Sign In for Pricing
View Details
Recombinant Human TGOLN2/TGN38 Homolog Protein (His Tag)
PKSH033103-01 10 µg

Recombinant Human TGOLN2/TGN38 Homolog Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TGOLN2/TGN38 Homolog Protein (His Tag)
PKSH033103-02 50 µg

Recombinant Human TGOLN2/TGN38 Homolog Protein (His Tag)

Sign In for Pricing
View Details
HSPA7 / HSP70B Rabbit Polyclonal Antibody
AP18060PU-N 400 µL

HSPA7 / HSP70B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details