Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C1orf159 (C1orf159)

This Recombinant Human Uncharacterized protein C1orf159 (C1orf159) spans the amino acid sequence from region 19-380.

Product Specifications

Product Name Alternative

Uncharacterized protein C1orf159

UniProt

Q96HA4

Expression Region

19-380

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KSMENTVTRNSTAVINTQAEGTLSPPGLSSLPVVREWALTHTAQLPECCVDVVGVNASCP GASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAGPGAPFPMNRSSGTPGRPH PGAPRVAASLFLGTFFISSGLILSVAGFFYLKRSSKLPRACYRRNKAPALQPGEAAAMIP PPQSSGNSSCRIPLWGFPSLGQSQGALWVCPQTGLPGSGSRPPLPGSPGDPPTRQGQGRI WLVPPALDLSWIWPAPPARPPLIPVTSMLFPVPETWGLQERRTHHDRADPQYLLLLEVQL HPRTDAAGLRQALLSSHRFSGAGSGGPKSQPVRKPRYVRRERPLDRATDPAAFPGEARIS NV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ NADPH Regenerating Kit
15265-AAT 1000 Tests

ReadiUse™ NADPH Regenerating Kit

Sign In for Pricing
View Details
C14ORF140 (ZC2HC1C) (NM_001042430) Human Over-expression Lysate
LC420900 20 µg

C14ORF140 (ZC2HC1C) (NM_001042430) Human Over-expression Lysate

Sign In for Pricing
View Details
PDI (PDIA2) Human Gene Knockout Kit (CRISPR)
KN422382 1 Kit

PDI (PDIA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DRG2 (NM_001388) Human Over-expression Lysate
LY419961 100 µg

DRG2 (NM_001388) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rat DDR1 Kinase/CD167 Protein (His Tag)
PKSR030164 100 µg

Recombinant Rat DDR1 Kinase/CD167 Protein (His Tag)

Sign In for Pricing
View Details
Trmt1 Mouse Gene Knockout Kit (CRISPR)
KN518256 1 Kit

Trmt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details