Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pisum sativum Protein TIC 40, chloroplastic (TIC40)

This Recombinant Pisum sativum Protein TIC 40, chloroplastic (TIC40) spans the amino acid sequence from region 73-436.

Product Specifications

Product Name Alternative

Protein TIC 40, chloroplastic, Translocon at the inner envelope membrane of chloroplasts 40, PsTIC40

UniProt

Q8GT66

Expression Region

73-436

Origin

Pisum sativum (Garden pea)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SISSSNGQETTSVGVSPQLSPPPPSTVGSPLFWIGIGVGFSALFSVVASRVKKYAMQQAF KSMMGQMNTQNNPFDSGAFSSGPPFPFPMPSASGPATPAGFAGNQSQATSTRSASQSTVT VDIPATKVEAAAPAPDINVKEEVEVKNEPKKSAFVDVSPEETVQKNAFERFKDVDESSSF KEARAPAEASQNGTPFKQGFGDSPSSPSERKSALSVDALEKMMEDPTVQQMVYPYLPEEM RNPSTFKWMMQNPEYRQQLEAMLNNMGGGTEWDSRMMDTLKNFDLNSPDVKQQFDQIGLS PQEVISKIMANPDVAMAFQNPRVQAAIMDCSQNPMSIVKYQNDKEVMDVFNKISELFPGV SGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prr15l (NM_146026) Mouse Tagged ORF Clone
MG200303 10 µg

Prr15l (NM_146026) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD40 Recombinant Rabbit monoclonal Antibody
HA751331 100 µL

CD40 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HIPK2 Human Gene Knockout Kit (CRISPR)
KN420278 1 Kit

HIPK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RBM35A (ESRP1) (NM_001034915) Human Over-expression Lysate
LC422113 20 µg

RBM35A (ESRP1) (NM_001034915) Human Over-expression Lysate

Sign In for Pricing
View Details
Zbed4 Mouse Gene Knockout Kit (CRISPR)
KN519586 1 Kit

Zbed4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)
PKSQ050030-01 10 µg

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)

Sign In for Pricing
View Details