Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-393.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P03172

Expression Region

26-393

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYA VLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPY NKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAG WHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQ DVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAP PSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPSN2 (TECR) (NM_138501) Human Tagged ORF Clone Lentiviral Particle
RC202503L3V 200 µL

GPSN2 (TECR) (NM_138501) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VAV1 (NM_005428) Human Tagged ORF Clone
RG224806 10 µg

VAV1 (NM_005428) Human Tagged ORF Clone

Sign In for Pricing
View Details
REV1 Antibody
orb1255802 100 µL

REV1 Antibody

Sign In for Pricing
View Details
Phospho-CSK (Ser364) Rabbit Polyclonal Antibody (BF680)
orb2529450 100 µL

Phospho-CSK (Ser364) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Guanylate kinase (gmk)
MBS1463400-01 0.02 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans Guanylate kinase (gmk)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Guanylate kinase (gmk)
MBS1463400-02 0.1 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans Guanylate kinase (gmk)

Sign In for Pricing
View Details